PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT23538
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MIKC_MADS
Protein Properties Length: 400aa    MW: 45285.1 Da    PI: 8.0444
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT23538genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.82.2e-3183133151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
    SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
               krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  EMT23538  83 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 133
               79***********************************************95 PP

2K-box94.22.2e-312403364100
     K-box   4 ssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
               s++   ++e +a+++qqe++kL+++i++Lq+++R l+ +++++++l++L+qLe +Lek++ kiR++Knel+++++e++qk+e el+++n +Lr+k+ e
  EMT23538 240 SNS-GtVAEVNAQYYQQESSKLRQQISSLQNSNRSLVRDSVSTMTLRDLKQLEGRLEKGIAKIRARKNELMYAEVEYMQKREMELHNDNIYLRSKVSE 336
               333.25999**************************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.8875135IPR002100Transcription factor, MADS-box
SMARTSM004328.8E-4275134IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.93E-3076155IPR002100Transcription factor, MADS-box
CDDcd002654.02E-3976136No hitNo description
PRINTSPR004044.0E-327797IPR002100Transcription factor, MADS-box
PROSITE patternPS00350077131IPR002100Transcription factor, MADS-box
PfamPF003191.9E-2684131IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-3297112IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-32112133IPR002100Transcription factor, MADS-box
PfamPF014861.4E-23249334IPR002487Transcription factor, K-box
PROSITE profilePS5129714.101250340IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MAEGLKLAAE HSSATILIQS DCAVALKALS DDSLERSTYG QLADLSCGAS GVTVNDHQLA  60
APAPEDSAVA GSEKMGRGRI EIKRIENTTN RQVTFCKRRN GLLKKAYELS VLCDAEVALI  120
VFSSRGRLYE YSNNSVCVFD EFHFMWKKNV KWPVWLEKAH WKGELLSQLD RGSPCSMESS  180
LAGETCDSTS FGPMCHNYYY GCIVIRKQSV HKCVLIRDWT VTCSVKATIE RYKKANSDTS  240
NSGTVAEVNA QYYQQESSKL RQQISSLQNS NRSLVRDSVS TMTLRDLKQL EGRLEKGIAK  300
IRARKNELMY AEVEYMQKRE MELHNDNIYL RSKVSENERG QQPMNMMASG STSSEYDHMV  360
PPFDSRNFLQ ANILQQQQQQ QHYSQQLQPT ALQLGQQYFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-1875136162Myocyte-specific enhancer factor 2B
1tqe_R1e-1875136162Myocyte-specific enhancer factor 2B
1tqe_Q1e-1875136162Myocyte-specific enhancer factor 2B
1tqe_P1e-1875136162Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1887790.0KT188779.1 Aegilops tauschii WAG-2g MADS box transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230593.17e-96PREDICTED: MADS-box transcription factor 3 isoform X2
SwissprotQ407044e-93MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLM8BNZ00.0M8BNZ0_AEGTA; MADS-box transcription factor 3
STRINGMLOC_5375.21e-103(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-56MIKC_MADS family protein